Nama : M.Nur Fitriyanto
Nim : D1A012098
Prodi : Agroekoteknologi / C
Tugas : Bahasa Indonesia ( tugas ke-8)

Teknik dan cara penyampaian idato yang baik dan benar

1. Menggunakanbahasa yang mudahdipahamipendengar.
2. Menggunakancontohdanilustrasi yang mempermudahpendengardalammemahamikonsep yang abstrakapabiladiperlukan.
3. Memberipenekanandengancaramengadakanvariasidalamgayapenyajian.
4. Mengorganisasikanmaterisajiandenganurutdarihalmudahkehal yang sulitdanlengkap.
5. Menghindaripenggunaan kata-kata yang meragukandanberlebih-lebihan.
6. Program ataumateridisajikandenganurutan yang jelas.
7. Berikanikhtisarbutir-butir yang penting, baikselamasajianmaupunpadaakhirsajian.
8. Gunakanvariasisuaradalammemberikanpenekananpadahal-hal yang penting.
9. Kejelasanlafal, intonasi, nada, dansikap yang tepat agar pendengartidakbosanatauterkesanmonoton.
10. Membuatdanmengajukanpertanyaanuntukmengetahuipemahamanpendengar, minatpendengar, atausikappendengar, jikadiperlukan.
11. Menggunakan nada suara, volume suara, kecepatanbicarasecarabervariasi.
12. Menggunakanbahasatubuh yang mendukungkomunikasidenganpendengar.
13. Rileks. karenaparapendengarbisamelihatketeganganandadanhalinijustruakanmenghilangkanfokusandadalamberpidato, jadisebissamungkinbersikaplahtenang. biarkansajamengalir.
14. MenarikPerhatianPendengar, halinidimaksudkan agar parapendengartidakjenuhakanpidatoandaadabaiknyaandamenyisipkansedikitcandaandalamberpidato.

Komentarhasil pidato :

Titus Nova Halhandaka :
• Penggunaan bahasa : Sesuai dengan EYD atau KBBI
• Penggunaan kata-kata : sedikit ada pengulangan kata-kata
• Intonasi : Intonasi yang di tampilkan baik dan seuai pembahsaan
• Kejelasan lafal : Baik dan lancar dalam membacakan pidato
• Bahasa tubuh : Menggunakan bahasa tubuh yang sesuia dan tidak berlebihan
• Kepahaman : Baik dan cukup bisa dipahami oleh pendengar

M . Nur Fitriyanto :
• Penggunaan bahasa : Sesuai dengan EYD atau KBBI
• Penggunaan kata-kata : Ada pengulangan kata-kata
• Intonasi : Intonasi yang di tampilkan baik dan seuai pembahasaan
• Kejelasan lafal : Lafal yang di sampaikan cukup jelas, dan lancar
• Bahasa tubuh : Menggunakan bahasa tubuh yang sesuia dan tidak berlebihan
• Kepahaman : Baik dan cukup bisa dipahami oleh pendengar

Septi Mustika :
• Penggunaan bahasa : Sesuai dengan EYD atau KBBI
• Penggunaan kata-kata : Ada pengulangan kata-kata
• Intonasi : Intonasi yang di tampilkan baik
• Kejelasan lafal : Lafal yang di sampaikan cukup jelas, lancar
• Bahasa tubuh : Menggunakan bahasa tubuh yang sesuia dan tidak berlebihan
• Kepahaman :Baik dan cukup bisa dipahami oleh pendengar
Namun terlalu cepat dalam menyampaikan

Yudi Aditiya :
• Penggunaan bahasa : Sesuai dengan EYD atau KBBI
• Penggunaan kata-kata : Ada pengulangan kata-kata
• Intonasi : Intonasi yang di tampilkan kurang begitu jelas
• Kejelasan lafal : Lafal yang di sampaikan tidak lancar,
karena kurangnya penguasaan materi
• Bahasa tubuh : tidak menggunakan bahasa tubuh yang baik
• Kepahaman :Tidak bisa dipahami

Racman Mulyadi :
• Penggunaan bahasa : Sesuai dengan EYD atau KBBI
• Penggunaan kata-kata : Ada pengulangan kata-kata
• Intonasi : Intonasi yang di tampilkan kurang begitu jelas
• Kejelasan lafal : Lafal yang di sampaikan baik dan lancar
• Bahasa tubuh : menggunakan bahasa tubuh yang sesuai
• Kepahaman :Bisa dimengerti dan di pahami

Agus Supriyanto :
• Penggunaan bahasa : Sesuai dengan EYD atau KBBI
• Penggunaan kata-kata : Ada pengulangan kata-kata
• Intonasi : Intonasi yang di tampilkan baik
• Kejelasan lafal : Lafal yang di sampaikan baik dan lancar
• Bahasa tubuh : menggunakan bahasa tubuh yang sesuai
• Kepahaman :cukup bisa dipahami dengan baik

Joni :
• Penggunaan bahasa : Sesuai dengan EYD atau KBBI
• Penggunaan kata-kata : Ada pengulangan kata-kata
• Intonasi : Intonasi yang di tampilkan baik
• Kejelasan lafal : Lafal yang di sampaikan kurang lancar
• Bahasa tubuh : menggunakan bahasa tubuh yang kurang sesuai
• Kepahaman :cukup bisa dipahami dengan baik

Andreas :
• Penggunaan bahasa : Sesuai dengan EYD atau KBBI
• Penggunaan kata-kata : Ada pengulangan kata-kata
• Intonasi : Intonasi yang di tampilkan baik
• Kejelasan lafal : Lafal yang di sampaikan baik dan lancar
• Bahasa tubuh : menggunakan bahasa tubuh yang sesuai
• Kepahaman :dapat dipahami dengan baik

Zulfa Khoiriah :
• Penggunaan bahasa : Sesuai dengan EYD atau KBBI
• Penggunaan kata-kata : Ada pengulangan kata-kata
• Intonasi : Intonasi yang di tampilkan baik
• Kejelasan lafal : Lafal yang di sampaikan lancar
• Bahasa tubuh : menggunakan bahasa tubuh yang kurang sesuai
• Kepahaman : bisa dipahami dengan baik

TEMA PERTANIAN ORGANIK

Assalamu’alaikum Warahmatullahi Wabarakatu

Selamat Pagi dan Salam sejahtera bagi kita semua.

Pertama –tama kita panjatkan puji syukur kehadirat Allah SWT yang telah melimpahkan segala rahmat, taufik, dan hidayahnya kepada kita sekalian. Sehingga kita masih dapat menikmati anugrah terindah nya berupa kesehatan dan kebahagiaan.
Shalawat beriring salam mudah-mudahan tetap tercurahkan kepada junjungan Nabi Besar Kita Muhammad SAW yang telah menunjukkan kita dari jalan yang gelap gulita menuju jalan yang terang benderang.

Dipagi ini kita berkumpul,dan bertatap muka seperti biasa,, yang mana pada kesempatan ini saya menyampaikan banyak terima kasih kepada Ibu Made deviani duaja,
terima kasih atas waktu dan kesempatan yang telah diberikan sehingga sekarang saya bisa berdiri di hadapan hadirin untuk menjelaskan pentingnya makanan orgnanik bagi kesehatan kita.

Berdasarkan pada penelitian saya sendiri, saya menemukan banyak sekali hambatan bagi kita untuk hidup sehat di zaman ini. Dari lingkungan, polusi udara sudah memapar tubuh kita sehari-hari; junk food mengandung kalori dan lemak tinggi, tapi rendah protein dan vitamin; berbagai makanan yang dibubuhi MSG, pengawet, dan bahan berbahaya lainnya hingga sayuran dan buah-buahan yang terkontaminasi residu kimia dan pestisida dan orang yang supersibuk sehingga mudah stres dan melupakan olahraga. Lengkaplah sudah hambatan-hambatan menuju hidup sehat.

Di Israel, sebuah penelitian memaparkan bahwa pestisida bisa membuat kita mudah terserang sakit kepala, tremor, dan kejang. Di Belgia, penelitian terhadap beberapa wanita kanker payudara menemukan kadar pestisida di dalam darah mereka 6-9 kali lebih banyak dibandingkan dengan wanita sehat. Karena itu, mengonsumsi makanan organik adalah cara efisien untuk menghindari bahan-bahan kimia tersebut. Selain itu, dengan mengonsumsi makanan organik kita juga menjaga keseimbangan alam karena kita turut menentang pencemaran oleh zat kimia seperti pestisida dan pupuk buatan terhadap lingkungan.

Bagaimanakah cara memastikan sebuah produk makanan itu organik? Pertama, jaminan berdasarkan kepercayaan antara petani dan konsumen. Jaminan ini berlaku bagi para konsumen yang sudah lama mengenal sang petani dan yakin betul bahwa semua proses penanaman sayuran dan buah-buahannya terbebas dari zat kimia. Kuda adalah pendampingan. Konsumen bisa mendampingi sang petani dalam proses perkebunan atau pertaniannya untuk memastikan tidak adanya penggunaan zat kimia. Jaminan ketiga tidak lain yaitu sertifikat yang diberikan lembaga independen yang kompeten untuk produk-produk yang dinilai sudah memenuhi standar organik.

Sekali lagi saya tegaskan bahwa kita bisa hidup sehat jika kita mau. Ingatlah tiga jaminan tadi – kepercayaan, pendampingan, dan sertifikat. Ingatlah juga bahwa kita turut menjaga keseimbangan alam dengan mengonsumsi makanan-makanan organik.
Mungkin hanya itu yang dapat saya sampaikan,Jika ada kata-kata yang kurang berkenan saya mengucapkn mohon maaf.sedikit pantun dari saya “jika ada jarum yang patah jangan dsimpan di dalam peti,jika ada kata –kata yang salah jangan simpan dalam hati”.

Akhirukalam ,wabilahitofik walidayah wasalamualikum.wr.wb

1.Pertanyaan dari pantun oktavianus > mengenai makalah Peningkatan Budidaya dan produksi minyak nilam oleh Rheva Naldo.H
1. Berasal dari manakah minyak nilam ?
jawab : berasal dari Indonesia, Malaysia, India, Madagaskar, Cina dan sebagian daerah Amerika Latin seperti Paraguay dan Brazil.

2. Apa sajakah kegunaan minyak nilam ?
Jawab :
• sebagai wangi-wangian atau minyak gosok (untuk pengobatan) alami.
• Minyak atsiri paling umum digunakan adalah sebagai pengusir stress.
• Minyak ini juga dapat digunakan untuk penyembuhan berbagai masalah penyakit kulit.
• Minyak ini memiliki sifat anti penuaan (aging) dini.
• Minyak atsiri atau minyak nilam juga dapat mencegah timbulnya bau badan.

3. Bagaimanakah cara untuk menanam tanaman nilam ?
Jawab :
• Pertama siapkan bibit nilam yang ingin ditanam
• Kedua siapkan lahan
• Jarak tanam harus dijarakan kira kira 100 x 100
• Lalu lakukan penanaman
• Dan yang terakhir lakukan pemeliharaan

4. Umur berapakah tanaman nilam dapat di panen ?
Jawab : Umur nilam yang tepat untuk dipanen 6 – 8 bulan setelah tanam.

5. Sebutkan jenis jenis nilam yang ada ?
jawab :
• Pogostemon Cablin Benth
• Pogostemon Heynecnus Benth
• Pogostemon Hortensis BACKER Bent

2.Pertanyaan dari Ayub Novsel > mengenai makalah nanas oleh Rustam efendi
1. Iklim yang bagaimanakah buah nanas di budidayakan ?
jawab : Pada umumnya tanaman nanas ini toleran terhadap kekeringan serta memiliki kisaran curah hujan yang luas sekitar 1000-1500 mm/tahun. Akan tetapi tanaman nanas tidak toleran terhadap hujan salju karena rendahnya suhu. C.

Nanas tumbuh pada daerah dataran rendah dengan ketinggian 100-200 m di atas permukaan laut. Di daerah dataran tinggi, tanaman ini masih dapat tumbuh sampai ketinggian 1200 m dpl. Pertumbuhan optimum tanaman nanas antara 100-700 m dpl.

2. Sebutkan jenis-jenis dari buah nanas ?
Jawab : Berdasarkan habitat tanaman, terutama bentuk daun dan buah dikenal 4 jenis golongan nanas, yaitu : Cayenne (daun halus, tidak berduri, buah besar), Queen (daun pendek berduri tajam, buah lonjong mirip kerucut), Spanyol/Spanish (daun panjang kecil, berduri halus sampai kasar, buah bulat dengan mata datar) dan Abacaxi (daun panjang berduri kasar, buah silindris atau seperti piramida).

3. Apa sajakah manfaat buah nanas ?
Jawab :
• Mampu menyuplai kebutuhan akan vitamin C bagi tubuh manusia. Di mana tubuh manusia tidak memiliki kemampuan untuk memproduksi jenis vitamin ini secara alami.
• Kandungan vitamin B yang terdapat dalam buah nanas, menjadikan seseorang memiliki daya tahan yang lebih tinggi. Khususnya dalam hal ketahanan terhadap serangan virus dan penyakit.
• Mencegah dan menurunkan resiko terjadinya serangan jantung dan stroke pada manusia.
• Mempercepat proses penyembuhan luka luar.
• Mengobati atas serangan infeksi pada saluran pencernaan tubuh.
• Nanas mengandung baik jumlah serat dan karenanya, memperlakukan dan mencegah gangguan pencernaan dan juga menenangkan empedu.
• Vitamin B1 ditemukan dalam nanas membantu dalam meningkatkan sirkulasi darah serta meningkatkan pasokan oksigen ke sel-sel darah. Vitamin B1 juga membantu dalam metabolisme karbohidrat dalam tubuh.

4. Tanah yang bagaimana yang dapat ditanami oleh buah nanas?
Jawab :
• Pada umumnya hampir semua jenis tanah yang digunakan untuk pertanian cocok untuk tanaman nanas. Meskipun demikian, lebih cocok pada jenis tanah yang mengandung pasir, subur, gembur dan banyak mengandung bahan organik serta kandungan kapur rendah.
• Derajat keasaman yang cocok adalah dengan pH 4,5-6,5. Tanah yang banyak mengandung kapur (pH lebih dari 6,5) menyebabkan tanaman menjadi kerdil dan klorosis. Sedangkan tanah yang asam (pH 4,5 atau lebih rendah) mengakibatkan penurunan unsur Fosfor, Kalium, Belerang, Kalsium, Magnesium, dan Molibdinum dengan cepat.

5. Apa sajakah kandungan dari buah nanas?
Jawab :
• Komposisi alami nanas terdiri dari kalori, mineral (kalsium, fosfor, zat besi, natrium, kalium, magnesium, tembaga, mangan, dan selenium), gula (glukosa, dekstrosa, fruktosa), dan vitamin (A, B1, B2, B6, B12, C, E, K), dll
• 85 kalori ditemukan dalam 1 oz. atau 28g nanas kering.
• Kurang lebih sama, yaitu, 82,5 kalori yang didapat dari 165g dari potongan nanas segar.
• Menariknya, ½ cangkir nanas kalengan mengandung 80 kalori.
• Buah ini mengandung lemak minimum dan kandungan sodium dan tidak ada kolesterol sama sekali.
• Nanas merupakan sumber yang sangat baik dari vitamin C atau asam askorbat. 15mg vitamin C hadir dalam per 100 gram nanas segar.

3.Pertanyaan dari Singgih k > mengenai makalah Hama penyakit bayam oleh Tedi.N
1. Apakah klasifikasi dari sayur bayam ?
Jawab :
• Klasifikasi ilmiah
Kerajaan :Plantae
Divisi :Magnoliophyta
Kelas :Magnoliopsida
Ordo :Caryophyllales
Famili :Amaranthaceae
Upafamili :Amaranthoideae
Genus :Amaranthus

2. Sebutkan beberapa manfaat bayam yang anda ketahui ?
Jawab :
• Bayam diketahui memiliki kandungan hampir 20 persen dari kebutuhan serat makanan untuk tubuh.
• bayam juga diketahui mengandung flavonoid yakni sebuah phytonutrisi dimana memiliki anti kanker didalamnya
• Vitamin C dan E, betakaroten, mangan, seng dan selenium pun terdapat dalam sayuran yang satu ini. Antioksidannya mampu mencegah timbulnya osteoporosis, atherosclerosis dan tekanan darah tinggi.

3. Vitamin apa yang terkandung di dalam sayur bayam ?
Jawab :
• Vitamin A yang terkandung dalam bayam juga baik untuk kulit dan mampu mempertahankan kelembapan. Dengan begitu, Anda pun akan mampu mencegah munculnya jerawat, keriput, sampai mencegah terjadinya penuaan dini.

• Bayam juga mengandung vitamin K yang sangat baik untuk tulang dan mampu mencegah osteoporosis, serta mempertahankan kekuatan dan kepadatan tulang. Vitamin K juga memiliki peran untuk kesehatan sistem saraf dan fungsi otak.

4. Kandungan apa saja yang terdapat pada sayur bayam ?
Jawab :
• setiap 100 gram bayam terkandung 2,3 gram protein; 3,2 gram karbohidrat; 3 gram besi dan 81 gram kalsium. Bayam juga kaya akan berbagai macam vitamin dan mineral, yakni vitamin A, vitamin C, niasin, thiamin, fosfor, riboflavin, natrium, kalium dan magnesium.

5. Hama apa sajakah yang sering menyeang sayur bayam
Jawab :
• Serangga ulat daun (Spodoptera Plusia Hymenia)
Gejala:daun berlubang – lubang. Pengendalian: pestisida / cukup dengan menggoyangkan tanaman.

• Serangga kutu daun (Myzus persicae Thrips sp.)
Gejala: daun rusak, berlubang dan layu. Pengendalian: pestisida / cukup dengan menggoyangkan tanaman.

• Serangga tungau (Polyphagotarsonemus latus)
Gejala: daun rusak, berlubang dan layu. Pengendalian: pestisida / cukup dengan menggoyangkan tanaman.

• Serangga lalat (Liriomyza sp.)Gejala: daun rusak, berlubang dan layu. Pengendalian: pestisida / cukup dengan menggoyangkan tanamaN.

4. Pertanyaan dari Teddy Nurizal > mengenai makalah Khasiat buah mengkudu oleh
1. Kandungan apa saja yang terdapat pada buah mengkudu ?
Jawab :
 Senyawa yang terkandung dalam mengkudu di antaranya adalah
• xeronine
• plant sterois
• alizarin
• lycinen
• sosium
• caprylic acid
• arginine
• antra quinines trace elemens
• phenylalanine
• magnesium,

2. Apa sajakah manfaat dari buah mengkudu ?
Jawab :
• menetralkan radikal bebas
• menjaga kolesterol baik (HDL)
• meningkatkan energi
• menjaga kesehatan jantung
• meningkatkan sistem kekebalan tubuh
• mengatasi diabetes
• Mengatasi kanker
• juga bermanfaat menunjang kesehatan persendian dan kulit.
• mengatasi stroke

3. di dataran manakah mengkudu dapat tumbuh dengan baik ?
jawab : Tanaman ini tumbuh di dataran rendah hingga pada ketinggian 1500 m. Tinggi pohon mengkudu mencapai 3-8 m, memiliki bunga bongkol berwarna putih. Buahnya merupakan buah majemuk, yang masih muda berwarna hijau mengkilap dan memiliki totol-totol, dan ketika sudah tua berwarna putih dengan bintik-bintik hitam.

4. Apakah cirri cirri umum buah mengkudu?
Jawab :
• Pohon
Pohon mengkudu tidak begitu besar, tingginya antara 4-6 m. batang bengkok-bengkok, berdahan kaku, kasar, dan memiliki akar tunggang yang tertancap dalam. Kulit batang cokelat keabu-abuan atau cokelat kekuning-kuniangan, berbelah dangkal, tidak berbulu,anak cabangnya bersegai empat. Tajuknya suklalu hijau sepanjang tahun. Kayu mengkudu mudah sekali dibelah setelah dikeringkan. Bisa digunakan untuk penopang tanaman lada.

• Daun
Berdaun tebal mengkilap. Daun mengkudu terletak berhadap-hadapan. Ukuran daun besar-besar, tebal, dan tunggal. Bentuknya jorong-lanset, berukuran 15-50 x 5-17 cm. tepi daun rata, ujung lancip pendek. Pangkal daun berbentuk pasak. Urat daun menyirip. Warna hiaju mengkilap, tidak berbulu. Pangkal daun pendek, berukuran 0,5-2,5 cm. ukuran daun penumpu bervariasi, berbentuk segitiga lebar. Daun mengkudu dapat dimakan sebagai sayuran. Nilai gizi tinggi karena banyak mengandung vitamin A. yg katanya bisa menyembuhkan ambein

• Bunga
Perbungaan mengkudu bertipe bonggol bulat, bergagang 1-4 cm. Bunga tumbuh di ketiak daun penumpu yang berhadapan dengan daun yang tumbuh normal. Bunganya berkelamin dua. Mahkota bunga putih, berbentuk corong, panjangnya bisa mencapai 1,5 cm. Benang sari tertancap di mulut mahkota. Kepala putik berputing dua. Bunga itu mekar dari kelopak berbentuk seperti tandan. Bunganya putih, harum.

• Buah
Kelopak bunga tumbuh menjadi buah bulat lonjong sebesar telur ayam bahkan ada yang berdiameter 7,5-10 cm. Permukaan buah seperti terbagi dalam sel-sel poligonal (segi banyak) yang berbintik-bintik dan berkutil. Mula-mula buah berwarna hijau, menjelang masak menjadi putih kekuningan. Setelah matang, warnanya putih transparan dan lunak. Daging buah tersusun dari buah-buah batu berbentuk piramida, berwarna cokelat merah. Setelah lunak, daging buah mengkudu banyak mengandung air yang aromanya seperti keju busuk. Bau itu timbul karena pencampuran antara asam kaprik dan asam kaproat (senyawa lipid atau lemak yang gugusan molekulnya mudah menguap, menjadi bersifat seperti minyak atsiri) yang berbau tengik dan asam kaprilat yang rasanya tidak enak. Diduga kedua senyawa ini bersifat aktif sebagai antibiotik.

5. Apa klasifikasi buah mengkudu itu ?
jawab :
 klasifikasi dari Mengkudu (Morinda citrifolia L.)
adalah sebagai berikut.

• Filum :Plantae
• Divisi :Spermatophyta
• Class :Dycotyledoneae
• Ordo :Rubiales
• Famili :Rubiaceae
• Genus :Morinda
• Spesies :Morinda citrifolia L

5. Pertanyaan dari andreas damanik; mengenai makalah Jagung oleh Yudi aditiya
1. Apa nama klasifikasi dari tanaman jagung ?
Jawab :
 Klasifikasi ilmiah
• Kerajaan :Plantae
• Ordo :Poales
• Famili :Poaceae
• Genus :Zea
• Spesies :Z. mays
• Nama binomial : Zea mays ssp. Mays L.

2. Apa sajakah kandungan yang dimiliki oleh tanaman jagung ?
Jawab :
 Kandungan gizi Jagung per 100 gram
bahan adalah:
• Kalori : 355 Kalori
• Protein : 9,2 gr
• Lemak : 3,9 gr
• Karbohidrat : 73,7 gr
• Kalsium : 10 mg
• Fosfor : 256 mg
• Ferrum : 2,4 mg
• Vitamin A : 510 SI
• Vitamin B1 : 0,38 mg
• Air : :12 gr

3. Didaerah mana sajakah tanaman jagung dapat tumbuh dengan baik ?
Jawab : Lampung, jawa tengah ,

4. Apa sajakah jenis jagung yang anda ketahui ?
Jawab :
• Jagung Mutiara ( Zea mays var. indurata)
• Jagung Lekuk ( Zea mays var. inderata)
• Jagung Manis ( Zea mays var. saccharata)
• Jagung Brondong ( Zea mays var. everta)
• Jagung Tepung ( Zea mays var. amylaceae)
• Jagung Ketan ( Zea mays var. ceratina)
• Jagung Pod ( Zea mays var. tunicata)

5. Apa sajakah manfaat dari tanaman jagung?
Jawab :
 Memperbaiki pencernaan
Jagung memiliki banyak serat yang merupakan keuntungan besar untuk pencernaan. Hal ini dapat mencegah sembelit, wasir, dan bahkan menurunkan risiko kanker usus besar.

 Kaya mineral
Lebih dari yang bisa Anda pikirkan, jagung mengandung sebagian besar magnesium, tembaga besi, dan yang paling penting fosfor, yang diperlukan untuk kesehatan tulang. Nutrisi ini tidak hanya mencegah tulang Anda dari retak karena Anda bertambah tua, tapi juga meningkatkan fungsi ginjal.

 Merawat kulit
Jagung juga kaya akan antioksidan, yang membantu dalam menjaga kulit agar awet muda. Selain dikonsumsi sebagai makanan, dapat juga digunakan minyaknya yang merupakan sumber yang kaya asam linoleat. Tepung jagung juga berguna untuk meredakan iritasi pada kulit.

 Mencegah anemia
Anemia merupakan suatu kondisi dimana jumlah sel darah merah berkurang jauh karena kurangnya zat besi. Dengan demikian, jagung manis bermanfaat bagi kesehatan karena kaya akan vitamin B dan asam folat yang mencegah anemia.

 Mengontrol kolesterol
Kolesterol adalah zat yang diproduksi oleh hati. Ada dua jenis kolesterol, kolesterol baik (HDL) dan kolesterol jahat (LDL). Peningkatan kolesterol jahat karena asupan makanan berlemak melemahkan hati Anda dan juga dapat menyebabkan penyakit kardiovaskular. Vitamin C, karotenoid dan bioflavinoids yang terkandung dalam jagung manis menjaga jantung Anda tetap sehat dengan mengendalikan kadar kolesterol dan meningkatkan aliran darah dalam tubuh.

6. Pertanyaan dari Andreas Damanik > mengenai makalah Budidaya Sawi oleh Rewian Sinta

1. Apakah manfaat dari tanaman sawi ?
Jawab :
• Mencegah osteoporosis.
• Mencegah penyakit jantung
• Menjaga kornea mata agar selalu sehat
• Mencegah anemia
• Dapat melindungi kulit.
• Menyembuhkan luka serta daya tahan tubuh melawan infeksi dan stress
• Mencegah diabetes militus
• Tangkal macam-macam kanker
• Mencegah penyakit gondok

2. Sebutkan nama latin dari tanaman sawi ?
Jawab : (Brassica rapa)

3. Sebutkan beberapa jenis sawi yang anda ketahui ?
Jawab : jenis sawi ada dua macam yaitu sawi putih dan sawi hijau .

4. Vitamin apa yang ada pada tanaman sawi ?
Jawab : Selain vitamin E, betakaroten dan vitamin C pada sawi sangat baik untuk mencegah kolesterol dan penyakit jantung.

5. Daerah manakah yang bnyak memproduksi sayuran sawi ?
Jawab : kebanyakan ditanam di daerah Kab. Garut Jawa Barat

7. Pertanyaan dari Dwima Titus Nova Halhandaka > mengenai makalah Tebu oleh Joni
1. Negara manakah sebagai penghasil gula terbesar didunia ?
Jawab :
• Negara-negara penghasil gula terbesar adalah negara-negara dengan iklim hangat seperti Australia, Brasil, dan Thailand. Hindia-Belanda (sekarang Indonesia) pernah menjadi produsen gula utama dunia pada tahun 1930-an, namun kemudian tersaingi oleh industri gula baru yang lebih efisien.
• Pada tahun 2001/2002 gula yang diproduksi di negara berkembang dua kali lipat lebih banyak dibandingkan gula yang diproduksi negara maju. Penghasil gula terbesar adalah Amerika Latin, negara-negara Karibia, dan negara-negara Asia Timur.

2. Sebutkan klasifikasi dari tanaman tebu ?
Jawab :
 Klasifikasi ilmiah
• Kerajaan :Plantae
• Divisi :Magnoliophyta
• Kelas :Liliopsida
• Ordo :Poales
• Famili :Poaceae
• Genus : Saccharum L.

3. Tempat yang cocok untuk bertanaman tebu?
Jawab :
• Tebu tumbuh baik pada daerah beriklim panas dengan kelembaban lebih dari 60%.
• Suhu udara berkisar antara 28-34 derajat C.
• Tanah yang cocok adalah tanah subur, tidak berbatu, dengan air yang cukup.
• Ketinggian Tempat
• Ketinggian tempat yang baik untuk pertumbuhan tebu adalah 5-500 m dpl. Tetapi di beberapa tempat dengan ketinggian lebih dari 1000 m dpl, tebu juga bisa tumbuh sama bagusnya dibanding yang ditanam di daerah yang lebih rendah.

4. Hama dan penyakit apa yang ada tanaman tebu ?
Jawab :
1. Hama Penggerek Pucuk dan batang
Biasanya menyerang mulai umur 3 – 5 bulan. Kendalikan dengan musuh alami Tricogramma sp dan lalat Jatiroto, semprot PESTONA / Natural BVR.

2. Hama Tikus
Kendalikan dengan gropyokan, musuh alami yaitu : ular, anjing atau burung hantu

3. Penyakit Fusarium Pokkahbung
Penyebab jamur Gibbrella moniliformis. Tandanya daun klorosis, pelepah daun tidak sempurna dan pertumbuhan terhambat, ruas-ruas bengkok dan sedikit gepeng serta terjadi pembusukan dari daun ke batang. Penyemprotan dengan 2 sendok makan Natural GLIO + 2 sendok makan gula pasir dalam tangki semprot 14 atau 17 liter pada daun-daun muda setiap minggu, pengembusan tepung kapur tembaga ( 1 : 4 : 5)

4. Penyakit Dongkelan
Penyebab jamur Marasnius sacchari, yang bias mempengaruhi berat dan rendemen tebu. Gejala, tanaman tua sakit tiba-tiba, daun mengering dari luar ke dalam. Pengendalian dengan cara penjemuran dan pengeringan tanah, harus dijaga, sebarkan Natural GLIO sejak awal.

5. Penyakit Nanas
Disebabkan jamur Ceratocytis paradoxa. Menyerang bibit yang telah dipotong. Pada tapak (potongan) pangkas, terdapat warna merah yang bercampur dengan warna hitam dan menyebarkan bau seperti nanas. Bibit tebu direndam dengan POC NASA dan Natural GLIO.

5. Apa sajakah manfaat dari tanaman tebu ?
Jawab :
• Hambat Plak
Tebu mengandung senyawa octacosanol sejenis alcohol rantai panjang yang mampu menurunkan kadar kolesterol dalm darah.
• AntiDiabetes
Menurut dr. C.J. Soegiharjo Apt. dari fakultas Farmasi Universitas Gajah Mada Yogyakarta, air perasan tebu memiliki efek anti diabetic. “Bila diminum Ia mampu mengatasi diabetes”paparnya ketika ia ditemui TRUBUS. Air tebu mengandung sakaran, senyawa anti diabetic.
• Melawan Kanker Payudara
Tebu mempunyai sifat alkali yang bisa membantu melawan kanker payudara dan prostat.
• Mencegah Stroke
Dengan mengkonsumsi air tebu secara teratur dapat membantu menjaga metabolisme tubuh akibat kekurangan cairan karena kegiatan yang kita lakukan, sehingga bisa membantu menghindari stroke.

8. Pertanyaan dari Pantun Oktavianus > mengenai makalah Alpukat oleh Dwima.Z.
1. Ada berapakah jenis alpukat yang anda ketahui ?
Jawab : Ras Meksiko,Ras Guatemala,Ras Hindia Barat.
2. Apa manfaat buah alpukat untuk kesehatan?
Jawab :
• Mencegah resiko penyakit strokeKandungan Asam Folat dalam Buah Avokad ini berpotensi mencegah resiko penyakit stroke. Caranya cukup dengan makan satu buah alpukat dalam sehari secara rutin.
• Menangkal radikal bebasKandungan Vitamin E, C atupun flavonoid akan menagkal radikal bebas. Sedangkan radikal bebas adlah penyebab utama timbulnya penyakt kanker. Konsumsi saja setip hari.
• Menjaga kesehatan mataKandungan vitamin A dalam buah alpukat berperan dalam melindungi mata dari degenerasi katarak dan makula.
• Menjaga kesehatan jantungKandungan asam folat yang tinggi akan menjaga kesehatan jantung. Satu gelas alpukat mengandung sekitar 23% dari total asam folat yang dibutuhkan tubuh.

3. Apa sajakah kandungan buah alpukat?
Jawab : Protein,karotenoid,anti-inflamasi,dll

4. Daerah yang cocok untuk bertanam buah alpukat?
Jawab :
Alpukat dapat ditanam di dataran rendah hingga dataran tinggi. Alpukat india barat baik ditanam pada ketinggian 0-600 m dpl, alpukat meksiko pada ketinggian 1000-3000 m dpl, dan alpukat guatemala pada ketinggian 600-2.000 m dpl. Semua tipe alpukat menghendaki tanah yang tidak mengandung cadas keras atau yang tandus.
Tanaman tidak tahan terhadap genangan air yang terus-menerus, tetapi tanaman lebih senang hidup di daerah beriklim basah dengan curah hujan 1.500-3000 mm. per tahun. Di daerah yang beriklim agak kering dengan bulan basah 7-9 bulan dan bulan kemarau (kering) 2-6 bulan, tanaman alpukat masih mampu hidup dan berbuah asalkan keadaan air tanahnya dangkal (100-150 cm) dan pH tanah 5,5-6,5. Pada kondisi yang sesuai, tanaman alpukat dapat berbuah 2-3 kali setahun.

5.Dari Negara manakah asal buah alpukat ?
Jawab :
• Buah yang berasal dari Meksiko dan Amerika Tengah ini banyak dibudidayakan di Amerika Selatan dan Amerika Tengah. Tingginya bisa mencapai 20 meter dan panjang daunnya sekitar 12-25 cm. Berkulit lembut dan berwarna hijau tua hingga ungu kecoklatan. Tektur dagingnya lembut berwarna hijau muda.

demikian lah hasil pertanyaan dan jawaban yang dapat saya berikan semoga bermanfaat yaaa ,,,,,,🙂😀

Nama : M. Nur Fitriyanto
Nim : D1A012098
Jurusan : Agroekoteknologi
Fakultas : Pertanian
Universitas Jambi

Tugas 2 : Bahasa Indonesia (makalah)

Pertanyaan diskusi dari makalah mengenai Rambutan
Yang di sampaikan oleh Rita sari

Pertanyaan

1. Dalam persentase tersebut ,anda menyebutkan bahwa ide dari makalah yang anda ambil adalah perawatan pada buah rambutan, apa alasan anda memilih topic tersebut ?

2. Kenapa tema anda adalah buah-buahan , sedangkan seperti yang kita tahu, buah-buahan lebih dari satu jenis dan anda hanya membahsan tentang rambutan saja?

3. Untuk merawat tanaman rambutan itu bias dengan penyiangan, penyiangan tersebut seperti apa ?

4. Apa sajakah manfaat dari buah rambutan tersebut ?

5. Apa alasan anda mempersentasekan makalah rambutan ini ?

Jawaban:

1.
Saya memilih topic tersebut di karena di dalam maklah yang saya persentasekan ada yang menjelaskan tentang perawatn buah rambutan tersebut.
karena ada berapa macam perawatan yang di lakukan di antaranya yaitu

 Pemeliharaan dan Pemupukan Buah Rambutan

PENJARANGAN DAN PENYULAMAN
Karena kondisi tanah telah gembur dan mudah tanaman lain akan tumbuh kembali terutama Gulma (tanaman pengganggu), seperti rumput-rumputan dan harus disiangi sampai radius 1-2 m sekeliling tanaman rambutan. Apabila bibit tidak tumbuh dengan baik segera dilakukan penggantian dengan bibit cadangan.

PEREMPALAN
Agar supaya tanaman rambutan mendapatkan tajuk yang rimbun, setelah tanaman berumur 2 tahun segera dilakukan peempelan/ pemangkasan pada ujung cabang-cabangnya. Disamping untuk memperoleh tajuk yang seimbang juga berguna memberi bentuk tanaman, memperbanyak dan mengatur produksi agar tanaman tetap terpelihara

PEMUPUKAN

Untuk menjaga agar kesuburan lahan tanaman rambutan tetap stabil perlu diberikan pupuk secara berkala

PENGAIRAN DAN PENYIRAMAN

Selama dua minggu pertama setelah bibit yang berasal dari cangkokan/okulasi ditanam, penyiraman dilakukan sebanyak dua kali sehari, pagi dan sore. Dan minggu-minggu berikutnya penyiraman dapat dikurangi menjadi satu kali sehari.

WAKTU PENYEMPROTAN PESTISIDA

Guna mencegah kemungkinan tumbuhnya penyakit/hama karena kondisi cuaca/hewan-hewan perusak maka perlu dilakukan penyemprotan pestisida umumnyadilakukan antara 15-20 hari sebelum panen dan juga apabila kelembaban udara terlalu tinggi akan tumbuh cendawan, apabila musim penghujan mulai tiba perlu disemprot fungisida beberapa kali selama musim hujan pestisida dan insektisida

Dari data yang ada di atas saya menentukan ide yaitu bagaimana cara merawat rambutan .

2. Saya memilih tema tersebut karena membahas tentang semua jenis rambutan yang ada di Indonesia sendiri bukan hanya dalm kontek satu jenis saja karena banyak sekali jenis-jenis rambutan yang ada di Indonesia sendiri yaitu….

Rambutan Rapiah
buah tidak terlalu lebat tetapi mutu buahnya tinggi, kulit berwarna hijau-kuning-merah tidak merata dengan beramut agak jarang, daging buah manis dan agak kering, kenyal, ngelotok dan daging buahnya tebal, dengan daya tahan dapat mencapai 6 hari setelah dipetik.

Rambutan Aceh Lebak bulus
pohonnya tinggi dan lebat buahnya dengan hasil rata-rata 160-170 ikat per pohon, kulit buah berwarna merah kuning, halus,rasanya segar manis-asam banyak air dan ngelotok daya simpan 4 hari setelah dipetik, buah ini tahan dalam pengangkutan.

Rambutan Cimacan
kurang lebat buahnya dengan rata-rata hasil 90-170 ikat per pohon, kulit berwarna merah kekuningan sampai merah tua, rambut kasar dan agak jarang, rasa manis, sedikit berair tetapi kurang tahan dalam pengangkutan.

Rambutan Binjai
yang merupakan salah satu rambutan yang terbaik di Indonesia dengan buah cukup besar, dengan kulit berwarna merah darah sampai merah tua rambut buah agak kasar dan jarang, rasanya manis dengan asam sedikit, hasilbuah tidak selebat aceh lebak bulus tetapi daging buahnya ngelotok.

Rambutan Sinyonya
jenis rambutan ini lebat buahnya dan banyak disukai terutama orang Tionghoa, dengan batang yang kuat cocok untuk diokulasi, warna kulit buah merah tua sampai merah anggur, dengan rambut halus dan rapat,rasa buah manisa sam, banyak berair, lembek dan tidak ngelotok.

3.
Penyiangan dilakukan seperti mencabut/membasmi bila gulma telah tumbuh di sekitar tanaman. Tanah di sekitar tanaman perlu digemburkan, tetapi jangan sampai merusak akar.

4.
Ada beberapa manfaat dari buah rambutan diantar nya

Mengatasi sariawan
Caranya adalah cuci kulit kayu rambutan (tiga ruas jari), lalu rebus dengan dua gelas air bersih sampai tersisa satu gelas. Gunakan untuk berkumur selagi hangat.


• Menurunkan kadar gula darah

Biji buah rambutan sangat berkhasiat menurunkan kadar gula darah (hipoglikemik). Bagaimana caranya? Yaitu ambilah lima buah rambutan yang sudah masak, pisahkan bijinya. Potong biji rambutan menjadi bagian-bagian kecil, lalu sangria sampai berwarna kuning kehitaman. Giling halus sampai menjadi bubuk. Masukkan seluruh bubuk ke dalam cangkir, seduh dengan air panas. Setelah dingin, minum bagian air yang bening sekaligus buang ampas atau endapannya. Lakukan sebelum makan sebanyak 1-3 kali sehari, tergantung pada seberapa tinggi kadar gula saat melakukan terapi ini. Konsumsi setiap hari jika perlu.

Mengobati kencing manis
Untuk anda yang mengalami Kencing manis silahkan sediakan 5 (lima) biji rambutan lalu gongseng dan giling sampai menjadi serbuk. Seduh dengan satu cangkir air panas. Setelah dingin, minum airnya sekaligus 1-2 kali sehari.


• Disentri

Untuk mengobati disentri caranya adalah cuci kulit buah rambutan (10 buah), potong-potong seperlunya. Tambahkan tiga gelas minum air bersih, lalu rebus sampai airnya tersisa separuhnya. Setelah ,dingin, saring dan minum sehari dua kali, masingmasing tiga perempat gelas.


• Mengobati demam

Caranya; cuci kulit buah rambutan yang telah dikeringkan (15 g). Tambahkan tiga gelas air bersih, lalu rebus sampai mendidih selama 15 menit. Setelah dingin, saring dan minum tiga kali sehari, masing-masing sepertiga bagian.

Menghitamkan rambut beruban.
Berikut caranya; cuci daun rambutan secukupnya, lalu tumbuk sampai halus. Tambahkan sedikit air sambil diaduk merata sampai menjadi adonan seperti bubur. Peras dan saring dengan sepotong kain. Gunakan air yang terkumpul untuk membasahi rambut kepala. Lakukan setiap hari sampai terlihat hasilnya.

Buah rambutan mengandung karbohidrat, protein, lemak, fosfor, besi, kalsium., dan vitamin C. Kulit buah mengandung tanin dan saponin. Biji mengandung lemak dan polifenol. Daun mengandung tanin dan saponin. Kulit batang mengandung tanin, saponin, flavonoida, pectic substances, dan zat besi.

5.

Alasan saya mempersentasekan makalah ini yaitu di dalam makalah tersebut terdapat bagaimana cara perawatan dan manfaat dari buah rambutan itu sendiri , dengan demikian pembaca dapat mengetahui bagaimana cara merawat buah rambutan yang baik dan benar serta pembaca juga tahu apa saja manfaat dari buah tersebut.

terima kasih🙂😀

(tugas bahasa indonesia 1)

MAKARA, KESEHATAN, VOL. 9, NO. 1, JUNI 2005: 23-28 23
23
ANALISIS MIKROBIOLOGI ESCHERICHIA COLI O157:H7
PADA HASIL OLAHAN HEWAN SAPI DALAM PROSES PRODUKSINYA
Ratu Ayu Dewi Sartika, Yvonne M. Indrawani, Trini Sudiarti
Departemen Gizi Kesehatan Masyarakat, Fakultas Kesehatan Masyarakat, Universitas Indonesia,
Depok 16424, Indonesia
Email: ayu_fkm_ui@yahoo.com

abstrak
Masalah di bidang penyehatan makanan adalah masih tingginya tingkat kontaminasi bakteri makanan yang disajikan
oleh berbagai penyelenggara makanan, antara lain pedagang kaki lima, restoran, jasa boga dan industri makanan.
Produk daging dan susu sapi serta olahannya merupakan jenis makanan yang berisiko tinggi terhadap bahaya
kontaminasi. Dengan demikian perlu dilakukan pengamanan makanan terhadap pencemaran bakteri terutama yang
disebabkan oleh E.coli O157:H7, khususnya yang berasal dari bahan makanan mentah terkait dengan rantai makanan
mulai dari proses produksi sampai sebelum dikonsumsi. Walaupun jenis bakteri patogen ini merupakan flora normal
pada usus hewan ternak, tetapi perlu juga diwaspadai adanya wabah karena pencemaran E.coli O157:H7 terhadap produk
sapi yang dihasilkan. Untuk mengantisipasi keganasan Escherichia coli O157:H7 ini, maka perlu dilakukan penelitian
untuk melihat mata rantai perjalanan bakteri patogen ini mulai dari tahap produksi sampai ke tingkat pedagang. Tujuan
dari penelitian adalah untuk mengetahui adanya bakteri E.coli O157:H7 pada produk daging dan susu yang terdapat pada
Rumah Pemotongan Hewan (RPH), peternakan sapi, pasar tradisional dan pedagang lainnya serta mengetahui faktorfaktor
yang berpengaruh terhadap penyebarannya. Desain survei yang digunakan untuk penelitian ini adalah desain
cross sectional. Bahan pemeriksaan berupa air/susu sebanyak 250 ml susu/air dan daging sapi sebanyak 250 gram
daging sapi/karkas. Pemeriksaan bakteriologi dilakukan secara kualitatif yang terdiri atas presumptive test, comfirmed
test, dan completed test, sedangkan kuantitatif terdiri atas Total Plate Count (TPC) dan MPN (Most Probable Number)
yaitu perkiraan jumlah kuman yang mendekati per 100 ml air. Hasil pemeriksaan menunjukan bahwa semua daging
(100% daging) yang berasal dari RPH dan pasar tradisional telah terkontaminasi oleh E.coli O157: H7, sebagian besar
susu segar dan yang dipasteurisasi (73.7%) yang berasal dari Peternakan Sapi Perah (PSP) dan pedagang/industri skala
rumah tangga telah terkontaminasi oleh E.coli O157: H7, demikian juga dengan sebagian besar sampel air (60%) dan
tenaga penjamah (41.7%) telah terkontaminasi oleh micro organism ini.

Abstract
Microbiological analysis of Escherichia coli O157:H7 on Cow’s Products during the Production Process. The
problem on food health is the high amount of bacterial contamination of food served by several kinds of food sellers,
e.g. vendors, restaurants, caterers and food industries. Meat and milk products are kinds of food prone to contamination.
To secure food against contamination by bacteria such as E. coli O157:H7, especially related to raw food, should begin
with the securing of products through the whole production process till it reaches the consumers. Although these
pathogenic bacteria are part of the normal flora in the intestines of cattle, however we should be aware of the possibility
of an outbreak in the community due to E. coli O157:H7 contamination of beef products. To anticipate the danger of an
outbreak a study should be conducted to know about this microorganism from the beginning i.e. the production phase
until the seller phase. The aim of this research is to know the existence of E. coli O157:H7 on beef and milk products
obtained from abattoirs, cow ranches, traditional markets and other sellers in addition with knowing the influencing
factors on the spreading of the microorganism. The survey design used for this research is the cross sectional design.
The material used for the tests are 250 ml water/milk and 250 gram beef/carcass. The bacterial tests included qualitative
tests as follows: presumptive test, confirmed test, completed test, whereas quantitatively tests as follows: Total Plate
Cound (TPC), Most Probable Number (MPN), which is a near amount prediction of bacteria per 100 ml of water.
Results showed that all meat (100%) coming from abattoirs and traditional markets were contaminated with E. coli
O157:H7, in addition with most of the fresh and pasteurized milk samples (73.3%) coming from cattle ranches and home
industries. Contamination was also found in most of the water samples (60%) and in food handlers (41.7%).
Keywords: Escherichia coli O157:H7, contamination, meat, milk
24 MAKARA, KESEHATAN, VOL. 9, NO. 1, JUNI 2005: 23-28

1. Pendahuluan
Protein hewani merupakan sumber energi dan
penunjang pokok hidup manusia. Bahan protein asal
hewan banyak diproduksi baik secara tradisional
maupun modern. Bahan mentah seperti susu sapi
(perahan) maupun daging potongan terlihat banyak
dijual di pasar-pasar tradisional dan pasar swalayan.
Adapula yang dijual dalam bentuk makanan jadi yang
tersedia di warung-warung, restoran siap santap (fast
food) sampai restoran hotel. Sedangkan bagi produk
susu selain dijual dalam keadaan murni, terdapat juga
dalam bentuk susu pasteurisasi (skala rumah tangga dan
industri), dan yoghurt.
Secara keseluruhan proses produksi yang berasal dari
hewan sapi merupakan mata rantai yang
berkesinambungan mulai dari awal proses produksi,
penanganan makanan sampai penyajian di meja makan.
Hal ini tidak luput dari perhatian mulai dari produsen
sampai dengan konsumen. Produsen dalam memberikan
pelayanannya akan menyediakan produk yang baik dan
aman, sementara pihak konsumen akan membeli produk
yang aman dan bermutu bagi dirinya. Dalam kalimat
terakhir ini tampaknya mudah tetapi dalam
pelaksanaannya sangat sukar, karena menyangkut
banyak hal yang berpengaruh antara lain segi sosial,
ekonomi dan budaya seseorang.
Pada tahun 1995, di Amerika dilaporkan bahwa dalam
tiga tahun terakhir banyak kejadian diare berdarah yaitu
hemolytic uremic syndrome (HUS) pada masyarakat
yang mengkonsumsi daging sapi/burger dan susu yang
tidak dipasteurisasi. Dinyatakan bahwa makanan
tersebut telah terkontaminasi oleh E.coli O157:H7.
Tertularnya manusia dapat disebabkan oleh makanan
yang terinfeksi E.coli O157:H7 baik secara langsung
maupun tidak langsung. Utamanya bersumber dari
hewan sapi melalui teknologi industri yang mengolah
makanan serta sumber lain yang telah tercemar oleh
kuman ini, misalnya di RPH (Rumah Pemotongan
Hewan), pada waktu proses pengolahan, distribusi dan
penyimpanan daging karkas, pada saat persiapan di
dapur dan saat penyajian makanan.
Kontaminasi dapat berasal dari hewan produksi
(peternakan) atau juga dari tenaga penjamah itu sendiri.
Sedangkan kontaminasi silang dapat terjadi bila
makanan jadi yang diproduksi berhubungan langsung
dengan permukaan meja atau alat pengolah makanan
selama proses persiapan yang sebelumnya telah
terkontaminasi kuman patogen.
Manusia yang terpapar oleh kuman E.coli O157:H7
disebabkan oleh kontak langsung dengan hewan infektif
atau akibat mengkonsumsi makanan seperti daging,
buah, sayur, air yang telah terkontaminasi serta susu
yang belum dipasteurisasi. Manure (kotoran sapi)
merupakan sumber penularan E.coli O157:H7 terhadap
manusia. Apabila lahan pertanian menggunakan manure
sebagai pupuk organik, maka kemungkinan besar akan
menjadi sumber penularan kuman patogen melalui
makanan, contohnya kentang, cedar apel, sawi, kol dan
jenis sayuran lainnya.
Peningkatan keamanan pangan terhadap makanan asal
hewan yang akan dikonsumsi manusia dan penanganan
buah atau sayur-sayuran segar yang dipupuk dengan
kotoran sapi, perlu ditegakkan untuk mencegah dan
menurunkan prevalensi food borne pathogens selama
dalam mata rantai penyiapan makanan mulai dari
produksi protein hewani di peternakan sampai dengan di
tingkat rumah tangga. Di Indonesia, kotoran sapi
mempunyai nilai ekonomis bagi keluarga petanipeternak
yaitu digunakan untuk memupuk tanah
pertanian seperti sayur dan buah. Oleh karena itu perlu
diwaspadai adanya infeksi karena kuman patogen ini.
Infeksi E.coli O157:H7 yang patogen pada manusia yaitu
yang bersifat verotoksigenik yang telah menyebabkan
16.000 kasus penyakit melalui makanan (Food Borne
Diseases) dan 900 orang meninggal per tahun di AS,
dengan perkiraan annual cost $ 200,000 hingga $
600,000 (Buzby dkk, 1996). Kejadian wabah tunggal
pada tahun 1993 di Western AS telah menyebabkan 700
orang menderita sakit dan 4 orang meninggal.
Meskipun prevalensi Escherichia coli O157:H7 sangat
kecil, dari 63% feedlot yang diteliti, hanya 1,8% adalah
positif Escherichia coli O157:H7. Akan tetapi dampak
yang ditimbulkan sangatlah besar. Sepertinya kuman ini
tidak tunduk dengan metode penanganan hewan secara
tradisional yang biasanya dilakukan di RPH (Rumah
Pemotongan Hewan), misalnya pengujian awal,
karantina hewan sebelum dipotong dan saat pemotongan
hewan. Oleh karena itu, ukuran kontrolnya tergantung
dari banyak faktor, seperti penanganan selama proses
produksi, transportasi dan distribusi produk sampai ke
pedagang eceran serta saat persiapan penanganan
makanan oleh konsumen. Hendaknya mereka mengikuti
tahap-tahap prosedur kontrol analisis untuk menentukan
titik kritis yang berbahaya, terutama dalam perencanaan
pemotongan hewan serta terlaksananya manajemen
peternakan yang baik untuk menurunkan infeksi
Escherichia coli O157:H7.
Kejadian besar wabah Hemorrhagic Colitis (HC) dan
Hemolytic Uremic Syndrome (HUS) yang disebabkan
oleh Escherichia coli, dilaporkan dari Washington,
Idaho, California dan Nevada antara 15 Nopember 1992
dan 28 Februari 1993. Serotipe Escherichia coli dari
Washington sendiri adalah O157:H7 yang berhasil
diisolasi dari 447 kasus, dan diketahui 3 anak
meninggal. Di Idaho, terdapat 14 orang positif terinfeksi
Escherichia coli O157:H7, 4 orang sampai dirawat di
rumah sakit dan 1 anak meninggal. Di Nevada terdapat
MAKARA, KESEHATAN, VOL. 9, NO. 1, JUNI 2005: 23-28 25
58 kasus yang dapat didiagnosa, 9 orang dirawat di
rumah sakit dan 3 orang berkembang menjadi HUS.
Penyelidikan terhadap wabah regional ini diduga erat
kaitannya dengan konsumsi Hamburger dari restoran
siap santap, dimana dagingnya dipasok dari RPH yang
kemungkinan terkontaminasi Escherichia coli O157:H7.

2. Metode Penelitian
Jenis penelitian ini adalah survey menggunakan desain
cross sectional, untuk mengetahui adanya bakteri E.coli
O157:H7 pada produk daging dan susu yang terdapat
pada RPH, Peternakan sapi, pasar tradisional dan
pedagang lainnya serta mengetahui faktor-faktor yang
berpengaruh terhadap penyebarannya.
Sebanyak 250 ml susu/air yang diambil dari 2 lokasi
PSP (Peternakan Sapi Perah), masing-masing lokasi
diambil 8 sampel susu per ekor sapi dan 1 sampel air
yang dipakai untuk mencuci. Yaitu peternakan sapi
perah di daerah Kukusan, Depok dan Batutulis, Bogor
(16 sampel susu dari PSP, 2 sampel susu pasteurisasi
dari kereta Jakarta – Bogor, 1 sampel susu pasteurisasi
dari industri rumah tangga) dengan jumlah total 19
sampel susu. Sedangkan sampel air sebanyak 5 sampel
diperoleh dari air cucian pada 2 PSP dan 2 RPH serta air
lantai pada 1 RPH.
Susu diambil langsung oleh pemerah susu (pada saat
sapi diperah langsung menggunakan tangan, tanpa
sarung tangan) menggunakan plastik steril. Plastik berisi
sampel susu dan air segera dimasukkan ke dalam termos
es dan dibawa ke Laboratorium Mikrobiologi Ibu Sri,
Bogor, untuk dilakukan pemeriksaan bakteriologis.
Pengambilan dan pemeriksaan dilakukan pada bulan
Juli 2003.
Sebanyak 250 gram daging sapi/karkas yang diambil
dari 2 lokasi Rumah Pemotongan Hewan dan 4 pasar
tradisional (masing-masing lokasi diambil 2 sampel
daging per ekor), yaitu Rumah Pemotongan Hewan sapi
di daerah Citeureup-Cibinong dan Kebon Pedes-Bogor,
serta pasar tradisional Anyar, Pasar Bogor, Pasar
Cibinong, dan Pasar Citeureup (Jumlah semua = 12
sampel daging sapi). Daging diambil langsung oleh
pemotong pada saat proses pemotongan menjadi karkas
menggunakan plastik steril. Plastik berisi sampel daging
segera dimasukan kedalam termos es dan dibawa ke
Laboratorium Mikrobiologi untuk dilakukan
pemeriksaan bakteriologis. Pengambilan dilakukan pada
bulan Juli 2003.
Pemeriksaan bakteriologis meliputi Penghitungan TPC,
Penghitungan MPN dan Identifikasi E.coli dan
penentuan Strain E.coli O157:H7
Metode pemeriksaan bakteriologi dilakukan secara:
a. Kualitatif: – presumptive test
– comfirmed test
– completed test
b. Kuantitatif: – Total Plate Count (TPC)
c. MPN (Most Probable Number): yaitu perkiraan
jumlah kuman yang mendekati per 100 ml air
Metode TPC (Total Plate count/jumlah hitung kuman
per ml air). TPC ditentukan dengan menanam dari tiap
contoh air:
a. 1 ml contoh air dan
b. 1 ml contoh air dengan penipisan 1 : 101 , 10 2
dan 1 : 103 masing- masing pada lempeng nutrient
secara pour plate .
Hasil pertumbuhan koloni dihitung dengan quibec
coloni counter dan dinyatakan dalam jumlah kuman per
ml air.
Metode MPN (Most Probably Number)1. Penentuan
MPN presumptive coliform/100 ml air. Pada
pemeriksaan ini dipakai laktosa broth dengan kekuatan
2 (double strength), 1.5 dan 1 strength. Dihitung tabung
Durham yang memberikan hasil reaksi positif (Tabung
Durham yang mengandung gas 10%) setelah
pengeraman 37oC selama 24 jam. MPN ditentukan
dengan mencocokkan dengan tabel Hoskin J.K dan
hasilnya dinyatakan dalam MPN coliform/100 ml air.
Penentuan MPN faecal coliform / 100 ml air. Dari setiap
tabung Durham reaksi positif presumptive coliform
diambil 1 mata ose dan ditanam ke dalam tabung.
Tabung Durham yang berisi Escherichia coli Broth
(E.C.medium). Hasil yang positif yaitu tabung Durham
yang mengandung 10% gas setelah pengeraman 37o C
selama 24 jam dicocokkan dengan tabel Hoskin J.K dan
hasilnya dinyatakan dalam faecal coliform / 100 ml air.
Penentuan MPN E.coli /100 ml air. Dari tiap Durham
reaksi positif faecal coliform diambil satu mata ose dan
ditanam pada lempeng medium EMB (Eosin Methylen
Blue) secara streaking. Biakan-biakan ini dieramkan 24
jam 37o C. Setelah pengeraman dihitung jumlah
lempeng yang ada pertumbuhan E.coli (=koloni dengan
warna metallic sheen) dan hasil biakkan positip
(=lempeng yang ada pertumbuhan E.coli) dicocokkan
dengan Tabel Hoskin J.K untuk menentukan MPN dari
E.coli/100 ml air.
Identifikasi E.coli patogen dan non patogen. Dilakukan
pemeriksaan biokimia, yaitu uji-uji I M Vi C (Indol,
MR. VP dan Citrat) dan uji gula-gula: Laktosa, Sukrosa,
galaktosa, sorbitol dan Glukosa

a. Hasil positif: akan terjadi perubahan warna pada
gula-gula tersebut

b. Penanaman E.coli pada media: McConkey Agar,
BGA (Briliant Blue Green Agar) dan SMAC
(Sorbitol McConkey Agar Escherichia coli)
26 MAKARA, KESEHATAN, VOL. 9, NO. 1, JUNI 2005: 23-28

Identifikasi Strain Escherichia coli O157:H7

a. Setelah penanaman kuman Escherichia coli suspect
pada Media SMAC akan terlihat koloni warna
merah dengan zona jernih disekitarnya
menunjukkan bahwa suspect positif Escherichia
coli O157:H7, karena lambat dalam
memfermentasikan sorbitol. Sedangkan yang bukan
strain O157:H7 akan memberikan gambaran berawan
warna merah jambu tanpa zona.

b. Terhadap koloni ini kemudian dilakukan pengujian
serologis yaitu dengan Latex Aglutinasi buatan
Oxoid. Positif akan menunjukkan agglutinasi
dengan gambaran yang halus.

c. Sebagai kontrol diuji juga Escherichia coli O157:H7
dan Escherichia coli O157:H7 standar yang berasal
dari Australia
Bahan pemeriksaan, berupa hapusan tangan dari petugas
pemotong hewan di RPH dengan menggunakan lidi,
kapas steril. Pekerja yang diambil sediaan hapusnya
antara lain pemerah susu yang terdapat pada 2 lokasi
peternakan sapi perah (masing-masing 1 orang) dan
pemotong sapi pada 2 lokasi RPH (masing-masing 1
orang) serta pedagang daging sapi pada 4 lokasi pasar
tradisional (masing-masing 1 orang).

Cara kerja :

a. Lidi kapas steril dioleskan pada tangan responden,
kemudian lidi dimasukkan ke dalam perbenihan
transport Cary-Blair dan segera dibawa ke
laboratorium. Hapusan tangan sebagian ditanam
langsung ke McConkey, BGA, Nutrient Agar
(persemaian) dan air pepton alkali.

b. Perbenihan yang telah ditanami kemudian
dieramkan selama 18 – 24 jam pada suhu 37 oC
c. Koloni yang tumbuh pada perbenihan kemudian
dimurnikan, lalu diidentifikasi dengan pemeriksaan
serologis dan biokimia

d. Apabila terdapat kuman patogen Escherichia coli
maka dilakukan isolasi dan ditanam pada SMAC
kemudian dieramkan pada suhu 37 oC selama 18 –
24 jam. Bila terdapat koloni merah dengan zona
putih di sekitarnya maka diduga kuman Escherichia
coli patogen. Selanjutnya kuman patogen ini diuji
secara serologis dan hasilnya dibandingkan dengan
kuman Escherichia coli standard.

3. Hasil dan Pembahasan
Hasil pemeriksaan mikroba pada daging sapi yang
berasal dari RPH Cibinong dan RPH Kota Bogor
menunjukkan hasil positif 100 % (12 sampel dari 12
sampel) terinfeksi Escherichia coli O157:H7, baik yang
berasal dari RPH maupun yang sudah didistribusikan di
pasar Citereup, pasar Cibinong, pasar Kebon Kembang
dan pasar Bogor. Keadaan tersebut menunjukkan bahwa
daging yang berasal dari RPH maupun yang telah
didistribusikan tidak memenuhi syarat kesehatan karena
telah tercemar bakteri E.coli O157:H7. Cemaran dapat
berasal dari kotoran sapi atau kotoran manusia. Infeksi
E.coli tersebut kemungkinan terjadi apabila pekerja
setelah membersihkan kandang dan kotoran hewan
(sapi) kemudian membersihkan diri dan mencuci alatalat
yang digunakan dari sumber air. Disamping itu
E.coli mempunyai habitat kehidupan alami di dalam
saluran pencernaan manusia dan hewan yang dapat
langsung mencemari bahan di sekelilingnya termasuk
air, tanah maupun daging 2. Meskipun demikian bila
dilihat dari pengamatan jumlah coliform maupun E.coli
daging sapi tersebut masih memenuhi syarat yang telah
ditetapkan untuk daging segar yaitu batas maksimum
cemaran mikroba coliform 1x 102 dan E.coli
MPN/gram 5 x 101 (RSNI, 1996). Hasil pemeriksaan
mikroba selengkapnya dapat dilihat pada Tabel 1.
Pemeriksaan Mikroba Susu Sapi. Susu sapi yang berasal
dari PSP di Kukusan, Depok dan Batutulis Kota Bogor
maupun susu yang telah dipasteurisasi baik yang berasal
dari Kukusan maupun dari Cilebut yang diperdagangkan
di atas kereta Jakarta – Bogor atau sebaliknya dijadikan
sampel penelitian. Terdapat 14 sampel (73,7%) dari 19
sampel susu yang terinfeksi Escherichia coli O157:H7
sehingga tidak memenuhi syarat untuk dikonsumsi
karena membahayakan manusia. E.coli O157:H7 dapat
menyebabkan hemoragik colitis (diare berdarah) dan
dapat menjadi sindrom hemolitik uremik dan
trombotik3. Kondisi tersebut menunjukkan bahwa susu
telah tercemar kotoran manusia atau hewan.
Namun bila dilihat dari kandungan coliform hanya 6
sampel (31,6 %) dari 19 sampel yang memenuhi batas
cemaran maksimum mikroba coliform .

MAKARA, KESEHATAN, VOL. 9, NO. 1, JUNI 2005: 23-28 27

Hasil pemeriksaan air yang berasal dari lantai RPH
Cibinong, air sumur RPH Kota Bogor, air sumur dari
PSP Batutulis menunjukkan positif tercemar
Escherichia coli O157:H7 sebesar 60% (3 dari 5 sampel
air). Kondisi tersebut menunjukkan kualitas air yang
kurang baik dan membahayakan untuk kepentingan
manusia. Air sumur tersebut baik yang berasal dari RPH
maupun PSP selain untuk kebutuhan ternak juga
digunakan oleh pekerja untuk keperluan mandi, cuci,
kakus (MCK), memasak serta untuk air minum. Secara
estetika air minum harus memenuhi syarat antara lain:
bebas bau, enak cita rasa dan memenuhi syarat
mikrobiologis yang direkomendasikan, yaitu 10 sel
bakteri coliform /100 ml air dan 1 sel E.coli / 100 ml air.
Bila ditinjau dari persyaratan tersebut hanya 1 sumber
air (sumur) PSP Kukusan yang memenuhi syarat meski
perlu dipertanyakan kembali.

pada Rumah Pemotongan Hewan, Penjual
daging di Pasar dan Pekerja Peternakan Sapi
Perah, Tahun 2003
No Swab Tangan MPN
coliform
MPN
E. coli
E.coli
O157 :H7
Ket.

28 MAKARA, KESEHATAN, VOL. 9, NO. 1, JUNI 2005: 23-28

Pencemaran E.coli O157:H7 kemungkinan dapat berasal
dari air yang digunakan untuk mencuci tangan ataupun
kebersihan pekerja setelah buang air besar tidak
mencuci tangan dengan menggunakan sabun atau bahan
disinfektan lainnya. Kemungkinan lain pekerja
memegang daging sapi yang tercemar MPN E.coli yang
berasal dari RPH. Hasil selengkapnya pengamatan
mikroba dengan cara hapusan tangan pekerja

4. Kesimpulan
Semua daging yang berasal dari RPH (Rumah
Pemotongan Hewan) dan pasar tradisional telah
terkontaminasi oleh E.coli O157: H7. Sebagian besar
susu segar dan pasteurisasi (73.7%) yang berasal dari
PSP (Peternakan Sapi Perah) dan pedagang/industri
skala rumah tangga telah terkontaminasi oleh E.coli
O157: H7.
Sebagian besar sampel air (60%) yang berasal
dari RPH (Rumah Pemotongan Hewan) dan PSP
(Peternakan Sapi Perah) telah terkontaminasi oleh
E.coli O157: H7. Sebanyak 41.7% dari tenaga penjamah
yang bekerja pada RPH (Rumah Pemotongan Hewan),
PSP (Peternakan Sapi Perah) dan pasar tradisional telah
terkontaminasi oleh E.coli O157: H7

Daftar Acuan

1. Badan Standarisasi Nasional. SNI 01-2332-1991:
Cara Penentuan MPN (Most Probable Number).
Jakarta: Badan Standarisasi Nasional, 1991.
2. Trihendrokesowo. Bakteri Dalam Air. Kursus
Singkat Fisiologi Bakteri, Yogyakarta: Pusat Antar
Universitas Bioteknologi Universitas Gadjah Mada,
1989.
3. Hanif SKS. Prevalensi Analisis Faktor-faktor
Kontaminasi Escherichia coli O157:H7 pada Sumber
Air Peternakan Sapi Perah Rakyat di Kabupaten
Sleman. Tesis. Program Pascasarjana Universitas
Gadjah Mada, Indonesia, 2003.
4. Suriawiria U. Mikrobiologi Air. Edisi kedua.
Bandung: Alumni, 1996.

TUGAS BAHASA INDONESIA
PEMBAHASAN JURNAL

PEMBAHASAN :
Selingkung Jurnal
Bentuk : PDF
Ukuran tulisan : 12
Lebar pinggir : Left 0,75 ,Right 0,75, Top 1 , Botton 1
Bentuk tulisan menggunakan hurup : Time New Roman

Judul Jurnal

ANALISIS MIKROBIOLOGI ESCHERICHIA COLI O157:H7
PADA HASIL OLAHAN HEWAN SAPI DALAM PROSES PRODUKSINYA
Keywords : Escherichia coli O157:H7, contamination, meat, milk
Nama Pengarang : Ratu Ayu Dewi Sartika, Yvonne M. Indrawani, Trini Sudiarti
Abstrak

Masalah di bidang penyehatan makanan adalah masih tingginya tingkat kontaminasi bakteri makanan yang disajikan oleh berbagai penyelenggara makanan, antara lain pedagang kaki lima, restoran, jasa boga dan industri makanan. Produk daging dan susu sapi serta olahannya merupakan jenis makanan yang berisiko tinggi terhadap bahaya kontaminasi. Dengan demikian perlu dilakukan pengamanan makanan terhadap pencemaran bakteri terutama yang disebabkan oleh E.coli O157:H7, khususnya yang berasal dari bahan makanan mentah terkait dengan rantai makanan mulai dari proses produksi sampai sebelum dikonsumsi

Abstract

Microbiological analysis of Escherichia coli O157:H7 on Cow’s Products during the Production Process. The problem on food health is the high amount of bacterial contamination of food served by several kinds of food sellers, e.g. vendors, restaurants, caterers and food industries. Meat and milk products are kinds of food prone to contamination. To secure food against contamination by bacteria such as E. coli O157:H7, especially related to raw food, should begin with the securing of products through the whole production process till it reaches the consumers.

Judul Jurnal

ANALISIS MIKROBIOLOGI ESCHERICHIA COLI O157:H7
PADA HASIL OLAHAN HEWAN SAPI DALAM PROSES PRODUKSINYA
Latar belakang jurnal
Secara keseluruhan proses produksi yang berasal dari hewan sapi merupakan mata rantai yang berkesinambungan mulai dari awal proses produksi, penanganan makanan sampai penyajian di meja makan. Hal ini tidak luput dari perhatian mulai dari produsen sampai dengan konsumen. Produsen dalam memberikan pelayanannya akan menyediakan produk yang baik dan
aman, sementara pihak konsumen akan membeli produk yang aman dan bermutu bagi dirinya. Dalam kalimat terakhir ini tampaknya mudah tetapi dalam pelaksanaannya sangat sukar, karena menyangkut banyak hal yang berpengaruh antara lain segi sosial, ekonomi dan budaya seseorang.
Pada tahun 1995, di Amerika dilaporkan bahwa dalam tiga tahun terakhir banyak kejadian diare berdarah yaitu hemolytic uremic syndrome (HUS) pada masyarakat yang mengkonsumsi daging sapi/burger dan susu yang tidak dipasteurisasi. Dinyatakan bahwa makanan tersebut telah terkontaminasi oleh E.coli O157:H7. Tertularnya manusia dapat disebabkan oleh makanan
yang terinfeksi E.coli O157:H7 baik secara langsung maupun tidak langsung. Utamanya bersumber dari hewan sapi melalui teknologi industri yang mengolah makanan serta sumber lain yang telah tercemar oleh kuman ini, misalnya di RPH (Rumah Pemotongan Hewan), pada waktu proses pengolahan, distribusi dan penyimpanan daging karkas, pada saat persiapan di dapur dan saat penyajian makanan.
Kejadian besar wabah Hemorrhagic Colitis (HC) dan Hemolytic Uremic Syndrome (HUS) yang disebabkan oleh Escherichia coli, dilaporkan dari Washington, Idaho, California dan Nevada antara 15 Nopember 1992 dan 28 Februari 1993. Serotipe Escherichia coli dari Washington sendiri adalah O157:H7 yang berhasil diisolasi dari 447 kasus, dan diketahui 3 anak meninggal. Di Idaho, terdapat 14 orang positif terinfeksi Escherichia coli O157:H7, 4 orang sampai dirawat di rumah sakit dan 1 anak meninggal. Di Nevada terdapat.

Metode Penelitian

Jenis penelitian ini adalah survey menggunakan desain cross sectional, untuk mengetahui adanya bakteri E.coli O157:H7 pada produk daging dan susu yang terdapat pada RPH, Peternakan sapi, pasar tradisional dan pedagang lainnya serta mengetahui faktor-faktor yang berpengaruh terhadap penyebarannya.

Tujuan Penelitian

• ANALISIS MIKROBIOLOGI ESCHERICHIA COLI O157:H7

• Serta Peningkatan keamanan pangan terhadap makanan asal hewan yang akan dikonsumsi manusia dan penanganan buah atau sayur-sayuran segar.

• Penelitian ini di lakukan di karena kan banyak nya Infeksi E.coli O157:H7 yang patogen pada manusia yaitu yang bersifat verotoksigenik yang telah menyebabkan 16.000 kasus penyakit melalui makanan (Food Borne Diseases) dan 900 orang meninggal per tahun di AS, dengan perkiraan annual cost $ 200,000 hingga $600,000 (Buzby dkk, 1996). Kejadian wabah tunggal pada tahun 1993 di Western AS telah menyebabkan orang menderita sakit dan 4 orang meninggal.

Daftar Acuan

1. Badan Standarisasi Nasional. SNI 01-2332-1991: Cara Penentuan MPN (Most Probable Number). Jakarta: Badan Standarisasi Nasional, 1991.

2. Trihendrokesowo. Bakteri Dalam Air. Kursus Singkat Fisiologi Bakteri, Yogyakarta: Pusat Antar Universitas Bioteknologi Universitas Gadjah Mada, 1989.

3. Hanif SKS. Prevalensi Analisis Faktor-faktor Kontaminasi Escherichia coli O157:H7 pada Sumber Air Peternakan Sapi Perah Rakyat di Kabupaten Sleman. Tesis. Program Pascasarjana Universitas Gadjah Mada, Indonesia, 2003.

4. Suriawiria U. Mikrobiologi Air. Edisi kedua.Bandung: Alumni, 1996.

laporan kimia dasar

Posted: December 5, 2012 in Uncategorized

LAPORAN PRAKTIKUM KIMIA DASAR
SIFAT-SIFAT UNSUR

OLEH :
NAMA : M. NUR FITRIYANTO
NIM : DIA012098
PRODI : AGROEKOTEKNOLOGI

FAKULTAS PERTANIAN
UNIVERSITAS JAMBI
2012
BAB 1
PENDAHULUAN

1.1 Latar Belakang
Pada awal abad ke-21 sekarang ini, ilmu kimia mengalami masa-masa paling berpendar semenjak perintisannya di paruh sejak abad ke-19. hasil penemuan baru dari berbagai penelitian dan eksperimen dapat kita nikmati dalam berbagai produk yang sering kita gunakan dalam kehidupan sehari-hari.
Susunan periodic sangat dikenal sebagai deretan unsure yang disusun menurut urutan nomor atom menjadi pedoman dalam penyelesaian pelajaran kimia dan yang terkait, seperti mengetahui wujud zat, nomor atom, nomor massa, kecenderungan antar unsure, dan masih banyak lagi.

Di dalam periodic unsure terdapat unsur-unsur yang dibagi menjadi beberapa golongan dan periodic. Golongan dalam susunan periodic dituliskan dalam bentuk kolom-kolom. Periodic dalam susunan periodic dituliskan dalam bentuk baris, unsure yang mempunyai sifat yang sama diletakkan dalam satu golongan.
Didalam susunan ini akan kita temukan nama-nama unsure disertai dengan symbol, jari-jari, nomor atom, dan nomor massanya. Saat ini, jumlah unsure yang terdapat dalam susunan periodic adalah 108 unsur, jumlah unsure ini masih dapat berubah, jika ada unsure baru yang di temukan lagi sesuai dengan perkembangan teknologi.
Oleh karena itu, praktikum ini dimaksudkan untuk menanbah pengetahuan praktikan tentang unsure-unsur kimia, terutama golongan alkali (IA) dan golongan alkali tanah (II), yang sebenarnya sering terjadi dalam kehidupan sehari-hari serta tingkat asam dan basanya.

1.2 Tujuan
– Mengetahui tingkat kelarutan suatu unsure dalam asam dan basa pada satu golongan
– Mengetahui fungsi dari indicator fenolftalien
– Mengetahui hubungan kelarutan suatu asam dengan Ksp garam serta pengaruh besarnya pengaruh besarnya Ksp suatu garam terhadap pengendapan

BAB 2
TINJAUAN PUSTAKA

Penggolongan periodic unsure-unsur

Menurut jenis subkulit yang berisi unsure-unsur dapat dibagi menjadi beberapa golongan unsure utama, yaitu gas mulia, unsure transisi (atau logam transisi), lantanida dan aktinida. Pada system periodic unsure-unsur utama (representative elements) adalah unsure-unsur dalam golongan IA hingga 7A, yang semuanya memiliki subkulit S dan P dengan bilangan kuantum utama berfungsi yang belum terisi penuh. Dengan pengecualian pada Helium, seluruh gas mulia ( noble gas) (unsure-unsur golongan 8A) mempunyai subkulit P yang terisi penuh, (konfigurasi elektronnya adalah 1S2 untuk Helium dan nss, nps untuk gas mulia yang lain, di mana n adalah bilangan kuantum utama untuk kulit terluar). Logam transisi adalah unsure-unsur dalam golongan 1B dan 3B hingga 8B, yang mempunyai subkulit d yang tidak terisi penuh atau mudah menghasilkan kation dengan subkulit d yang tak terisi penuh. (logam-logam ini kadang-kadang disebut dengan unsure-unsur transisi blok d).

Pada system periodic dapat dilihat bahwa unsure-unsur golongan IA adalah logam alkali memiliki konfigurasi electron terluar yang mirip, masing-masing memiliki inti gas mulia dan konfigurasi ns1 untuk electron terluarnya. Demikian pula pada golongan 2A, yaitu logam alkali tanah juga mempunyai inti gas mulia dan konfigurasi. Electron terluar ns2. electron terluar suatu atom, yang terlibat dalam ikatan kimia, sering disebut electron valensi (valenci electron). Jumlah electron valensi yang sama menentukan kemiripan perilaku kimia antara unsure-unsur dalam setiap golongan. Pengamatan ini juga berlaku untuk halogen ( unsur-unsur golongan 7A), yang memiliki konfigurasi electron terluar ns2, np5 dan menunjukkan sifat-sifat sangat mirip.

Konfigurasi electron Kation dan Anion

Karena banyak senyawa ionic yang terbentuk dari anion dan kation monoatomik, akan sangat membantu untuk mengetahui bagaimana menulis konfigurasi electron spesi-spesi ion ini. Prosedur untuk menulis konfigurasi electron ion-ion memerlukan metode yang hanya sedikit diperluas dari metode yang digunakan untuk atom netral. Dalam hal ini ion-ion dibagi dalam dua kelompok.

– Ion yang dihasilkan dari unsure golongan utama

Pada pembentukan kation dari atom netral unsure golongan utama, satu electron atau lebih dikeluarkan dari kulit n terluar yang masih terisi. Konfigurasi electron beberapa atom netral atau kation-kationnya yang terkait sebagai berikut.
Na : [Ne] 3s1 Na+ : [Ne]
Ca : [Ar] 4s2 Ca2+ : [Ar]
Al : [Ne] 3s2 3p1 Al3+ : [Ne]
Perhatikan bahwa setiap ion mempunyai konfigurasi gas mulia yang stabil.
Dalam pembentukan anion, satu electron atau lebih ditambahkan ke kulit n terluar yang terisi sebagian. Contoh-contoh sebagai berikut :
H : 1s1 H- : 1s2 atau [He]
F : 1s2, 2s2, 2p5 R- : 1s2, 2s2, 2p6 atau [Ne]
O : 1s2, 2s2, 2p4 O2- : 1s2, 2s2, 2p6 atau [Ne]
N : 1s2, 2s2, 2p3 N3- : 1s2, 2s2, 2p6 atau [Ne]

Sekali lagi, semua anion mempunyai konfigurasi electron gas mulia yang stabil. Jadi satu cirri khusus dari hamper semua unsure golongan utama adalah bahwa ion-ion yang dihasilkan dari atom-atom netrlnya mempunyai konfigurasi electron terluas gas mulia ns2 np6. ion-ion, atau atom-atom dan ion-ion, yang mempunyai jumlah electron yang sama, dan oleh karena itu konfigurasi electron tingkat dasarnya sama disebut isoelektron (isoelectronic). Jadi H- dan He adalah isoelektron, F, Na2, dan Ne adalah isoelektron, dan seterusnya.

– Kation yang dihasilkan golongan utama

Orbital 4s selalu diisi lebih dahulu sebelum orbital 3d. Mangan yang konfigurasi elektronnya adalah [Ar] 4s2 3d5. jika terbentuk ion Mn2+, mungkin dapat diduga dua electron dapat dikeluarkan dari orbital 3d untuk menghasilkan [Ar] 4s2 3d5. pada kenyataannya, konfigurasi Mn2+ ialah [Ar] 3d5! Alasannya adalah interaksi elektron-elektron dan electron inti pada atom netral berbeda dengan interaksi ionnya. Jadi, meskipun dalam Mn orbital 4s selalu terisi lebih dahulu sebelum 3d, electron dikeluarkan dari 4s pada pembentukan Mn2+, karena orbital 3d lebih stabil dari pada orbital 4s dalam ion logam transisi, electron yang dilepaskan pertama-tama selalu dari orbital ns dan kemudian baru dari orbital (n-1)d.

– Muatan inti efektif
Konsep muatan inti efektif memungkinkan kita untuk menjelaskan efek perisai pada sifat-sifat periodic. Misalnya, atom Helium yang mempunyai konfigurasi electron 1s2. kedua proton helium memberikan muatan +2 kepada inti, tetapi gaya tarik penuh dari muatan ini terhadap dua electron 1s sebagian diimbangi oleh tolak-menolak electron-elektron. Akibatnya, dapat dikatakan bahwa setiap electron 1s diperisai dari inti atom electron 1s lainnya. Muatan inti efektif, Zeff , dinyatakan dengan ;
Zeff = Z – s
Dengan Z adalah muatan inti sebenarnya (yaitu nomor atomnya) dan s (sigma) disebut konstanta perisai (shielding contant).

s lebih besar dari nol tetapi lebih kecil dari Z .
Salah satu contoh dari perisai electron adalah energi yang diperlukan untuk mengeluarkan satu electron dari atom berelektron banyak. Hasil pengukuran menunjukkan bahwa diperlukan energi sebesar 2372 KJ untuk mengeluarkan electron pertama dari satu mol atom He dan energi sebesar 5251 KJ untuk mengeluarkan electron kedua dari satu electron He+. Alasan diperlukannya lebih banyak energi untuk mengeluarkan electron kedua adlah bahwa dengan hanya terdapat atu electron, maka tidak ada perisai, dan electron itu merasakan seluruh pengaruh dari muatan inti +2.

Untuk atom-atom dengan juga electron atau lebih, electron pada kulit tertentu diperisai oleh electron pada kulit bagian dalam (yaitu, kulit yang lebih dekat dengan inti), tetapi tidak oleh electron pada kulit bagian luar. Jadi, unsure unsure litium yang konfigurasi elektronnya 1s1 2s1 , electron 2s diperisai oleh elekktron 1s, tetapi electron 2s tidak memberi efek perisai terhadap electron 1s, sebagai tambahan, kulit bagian dalam yang terisi penuh memerisai electron bagian luar dengan lebih efektif dari pada sub kulit yang menghasilkan konsekuensi yang penting untuk ukuran atom dan pembentukan ion-ion dan molekul-molekul.

– Jari-jari ion

Jari-jari atom ion adalah jari-jari kation atau anion. Jari-jari ion mempengaruhi sifat-sifat fisika dan kimia suatu senyawa ionic. Misalnya, struktur berdimensi tiga dari suatu senyawa ionic bergantung pada ukuran relative kation dan anionnya.

– Energi ionisasi
Kestabilan electron terluar ini tercermin secara langsung pada energi ionisasi atom tersebut. Energi ionisasi adalah energi minimum yang diperlukan untuk melepaskan satu electron dari atom berwujud gas pada keadaan dasarnya. Besarnya energi ionisasi merupakan ukuran usaha yang diperlukan untuk memaksa satu atom untuk melepaskan elektronnya.

– Kecenderungan umum dalam sifat-sifat kimia
Kecenderungan perilaku kimia unsure-unsur golongan utama adalah hubungan diagonal. Hubungan diagonal merujuk pada kemiripan yang ada antara pasangan unsur pada golongan dan periodic yang berbeda pada tabel periodic. Secara khusus, tiga anggota utama peridik kedua (Li, Be dan B) memperlihatkan banyak kemiripan dengan unsure-unsur yang terletak secara diagonal dibawahnya dalam tabel periodic.

Dalam membandingkan sifat-sifat unsure dalam golongan yang sama, harus diingat bahwa pembandingan paling berlaku dengan unsure-unsur sejenis. Paduan ini berlaku untuk unsure-unsur golongan 1A dan 2A, yang seluruhnya logam, dan golongan 7A seluruhnya non logam.

BAB 3
METODOLOGI PERCOBAAN

3.1 Alat dan Bahan
3.1.1 Alat- alat
– Tabung reaksi
– Gelas kimia 100 ml
– pinset
– Hot plate
– Gelas ukur 25 ml
– Pipet tetes
– Pipet Volum
3.1.2 Bahan-bahan
– BaCl2
– CaCl2
– NaOH
– Pita Mg
– Kalium
– Akuades
– Indikator fenolftalien

3.2 Prosedur

3.2.1 Kelarutan dalam garam sulfat

– Diambil 1 ml BaCl2 dan 1 ml H2SO4 dengan pipet tetes lallu dimasukkan ke dalam tabung reaksi
– Diambil 1 ml CaCl2 dan 1 ml H2SO4 dengan pipet tetes lalu dimasukkan ke dalam tabung reaksi dan di amati.

3.2.2 Kelarutan dalam garam Hidroksida
– Diambil 1 ml BaCl2 dan 1 ml NaOH dengan pipet tetes lalu di masukan ke dalam tabung reaksi.
– Di ambil 1 ml CaCl2 dan 1 ml NaOH dengan pipet tetes lalu di masukan ke dalam tabung reaksi dan di amati.

3.2.3 Reaktifitas unsure Mg + H2O
– Diambil 2 ml H2O dimasukan ka dalam gelas ukur lalu di panaskan.
– Diambil sedikit pita Mg dan di masukan kedalam H2O yang telah di panaskan.
– Ditambahkan indicator fenolftalien.

3.2.4 Rektifitas unsure K + H2O
– Diambil 50 ml H2O dan dimasukan ke dalam gelas kimia.
– Diambil logam K dengfan pinset dan di masukan pada gelas kimia yang berisi 50 ml H2O.
– Ditambahkan indicator fenolftalien.


BAB 4
HASIL DAN PEMBAHASAN

4.1 Tabel pengamatan
No. Perlakuan Pengamatan
A
1.

2.

B
3.

4.

5.

6. Kelarutan dalam garam sulfat
Pencampuran BaCl2 + H2SO4
– dimasukkan 1 ml BaCl2 + 1 ml H2SO4

Pencampuran CaCl2 + H2SO4
– Dimasukkan 1 ml CaCl2 + 1 ml H2SO4 dalam tabung reaksi

Kelarutan Dalam garam hidroksida
Pencampuran BaCl2 + NaOH
– Dimasukkan 1 ml BaCl2 + 1 ml NaOH ke dalam tabung reaksi

Pencampuran CaCl2 + NaOH
– Dimasukkan 1 ml CaCl2 + 1 ml NaOH ke dalam tabung reaksi

Reaktifitas unsure Mg + H2O
– Dimasukkan 2 ml air pada gelas bekker lalu dipanaskan
– Dimasukkan pita Mg dan ditambahkan indicator pp

Reaktofitas unsure K + H2O
– Dimasukkan 50 ml air pada gelas bekker
– Lalu logam K dengan menggunakan pinset, lalu dimasukkan pada gelas bekker yang berisi 50 ml air dan ditambahkan indicator pp

– Saat dicampur, campuran berwarna putih
– Terdapat banyak endapan pada campuran yang telah dicampurkan

– Saat dicampurkan, campuran tidak berwarna/ bening
– Tidak terdapat endapan

– Saat dicampurkan campuran berwarna ungu
– Setelah didiamkan, terdapat sedikit endapan

– Saat dicampurkan campuran berwarna putih
– Terdapat banyak endapan

– Adanya gas yang keluar dari pita Mg
– Larutan berubah warna menjadi warna merah lembayung

– Saat logam K di masukkan pada 50 ml air terjadi reaksi yaitu terbakar
– Saat diberi indicator pp, air berubah warna menjadi ungu tua

4.2 Reaksi- reaksi
4.2.1 Reaksi dengan garam sulfat
– BaCl2 + H2SO4 → BaSO4 + 2 HCl
– CaCl2 + H2SO4 → CaSO4 + 2 HCl
4.2.2 Reaksi dengan garam hidroksida
– BaCl2 + 2NaOH→ Ba(OH)2 + 2NaCl
– CaCl2 + 2NaOH → Ca(OH)2 + 2NaCl
4.2.3 Reaksi magnesium dengan air
– Mg + H2O → Mg(OH)2 + H2
– 2K + H2O → 2KOH + H2
4.2.4 Indikator fenolftalien

4.2.5 Mg + Indikator fenolftalien

4.3 Pembahasan

Garam hidroksi adalah garam yang bersifat basa. Apabila unsure=unsure dalam satu golongan di reaksikan dengan garam hidroksida maka unsure-unsur itupun bersifat basa, dalam satu golongan apabila seluruh anggotanya bersifat basa maka apabila dari atas ke bawah (samakin ke bawah) letak unsure maka akan semakin larut, sebaliknya bila dari bawah ke atas letak unsur maka sifat kelarutannya akan semakin kecil.
Garam sulfat adalah senyawa yang bersifat asam, bila unsure-unsur dalam satu golongan di reaksi dengan garam sufat yang bersifat asam maka unsure-unsur itupun bersifat asam. Dalam satu golongan bila seluruh unsur-unsur yang terdapat di dalamnya bersifat asam maka semakin ke atas sifat elarutannya semakin besar apabila semakin ke bawah sifat kelarutannya semakin kecil.

Logam alkali merupakan unsure yang sangat reaktif dan mudah untuk membentuk ion positif. Hal ini disebabkan oleh jumlah elektrin yang di lepas sedikit yaitu satu electron, sifat yang mencerminkan hal ini adalah energy ionisasi, dan ukuran jari-jari atom yang besar, misalnya dari natrium ke fransium, nomor atom dan jari-jari atom makin besar, sedangkan energy ionisasinya makin kecil sehingga logam alkali makin reaktif.

Bila dibandingkan sifat kereaktifitasan anatar logam alkali (golonga 1 A) dengan logam alkali tanah (golongan II A) maka logam alkali lebih reaktif dari pada logam alkali tanah, hal ini di sebabkan oleh jumlah electron yang di lepaskan. Semakin sedikit jumlah elektron yang di lepaskan maka akan semakin reaktif. Golongan I A melepaskan satu electron sedangkan golongan II A melepaskan dua electron.
Pada percobaan yang dilakukan, pada campuran BaCl2 ditambah H2SO4 menghasilkan endapan yang sangat banyak, sedangkan pada campuaran CaCl2 dengan H2SO4 menghasilkan sedikit endapan dari pada campuran BaCl2 dan H2SO4, hal ini di sebabkan H2SO4 bersifat asam, bila unsur-unsur dalam satu golongan direaksikan dengan H2SO4 yang bersifat asam maka semakin ke atas maka sifat kelarutannya semakin besar dan sebaliknya. Unsure Ba berada di bawah Ca, itulah yang menyebabkan campuran BaCl2 di tambah H2SO4 lebih banyak endapan dari pada campuran CaCl2 ditambah H2SO4.

Pada percobaan yang dilakukan, pada campuran BaCl2 ditambahkan NaOH menghasilkan endapan lebih sedikit di bandingkan campuran CaCl2 di tambahkan NaOH, hal ini disebabkan NaOH bersifat basa, bila unsur-unsur dala satu golongan direaksikan dengan NaOH yang bersifat basa maka unsur-unsur itupun bersifat basa, dalam satu golongan bila unsur-unsur yang terdapat didalamnya bersifat basa maka semakin ke atas sifat kelarutannya makin kecil dan sebaliknya. Unsur Ca berada di atas unsur Ba, itulah yang menyebabkan campuran BaCl2 di tambah NaOH endapannya lebih sedikit darim pada campura CaCl2 ditambah NaOH.

Telah dijelaskan bahwa logam alkali lebih reatif dari pada logam alkali tanah, sehingga K lebih reaktif dari pada Mg. untuk bereaksi dengan Mg air terlebih dahulu di panaskan, hal ini di sebabkan untuk mempercepat reaksi sedangkan reaksi K dengan air, air tidak perlu di panaskan. Jadi, saat K dimasukan ke dalam air langsung bereaksi, yaitu menghaslkan logam K yang langsung terbakar, hai ini di sebabkan logam K lebih reaktif dari pada Mg. Logam K dan pita Mg bila di reaksikan dengan air akan menghasilkan larutan yang bersifat basa, untuk mengetahui tingkat basa dari kedua logam tersebut maka di tambahkan indicator pp, saat di campurkan indicator pp pada campuran pita Mg dan air campuran menjadi warna merah lambayung sedangkan campuran logam K dengan air setelah di campurkan indicator pp berwarna ungu, hal ini artinya merah lambayung merupakan basa lemah dan warna ungu merupakan basa kuat, sehingga dapat di ketahui semakin ke kiri maka basanya makin kuat.

Pada percobaan ini di gunakan Reagan H2SO4 dan NaOH. Fungsi dari reagen ini adalah untuk mengetahui kelarutan satu golongan dalam asam dam basa. Dalam percobaan yang mempunyai sifat asam adalah H2SO4 dan yang bersifat basa adalah NaOH.

Unsur-unsur yang termasu loga alkali atau golonga I A adalah Litium(Li), Natrum(Na), Kalium(K), Rubidium(Rb), Sesium(Cs), Fransium(Fr), adapun sifat fisiknya adalah :
– Merupakan logam yang lunak
– Mudah di iris
– Mempunyai daya hantar listrik dan panas yang baik
– Titik leleh dan titik didihnya relative rendah
– Merupakan logam yang ringan

Adapun sifat logam alkali adalah sebagai berikut :
– Merupakn logam yang sangat reaktif
– Konfigurasi electron valensi adalah ns1
– Energi ionisasi relative rendah
– Mudah melepaskan electron valensi
– Semua senyawa logam alkali merupakan senyawa yang mudah larut dalam air
– Merupakan reduktor yang kuat

Unsur-unsur yang termasuk dalam logam alaklitanha atau golongan II A adalah Berilium(Be), Magnesium(Mg), Kalsium(Ca), Stronsium(Sr), Barium(Ba) dan Rarium(Ra). Adapun sifat fisiknya adalah :
– Mempunayi kilap logam
– Lebih keras dari logam alkali
– Dapat menghatar panas dan listrik yang baik, kecuali Berilium
– Radium merupakan unsur radio aktif

Adapun sifat kimia logam alkali tanah adalah :
– Merupakan logam yang reaktif
– Energi ionisasi semakin rendah
– Keelektronegatifan semakin kecil
– Daya reduksi semakin kuat
– Merupak reduktor yang cukup kuat

Afinitas electron adalah kemampuan untuk menerima satu atau lebih electron, ini merupakan sifat lain yang sangat menpengaruhi perilaku kimia atom-atom.
Energi ionisasi adalah energy minimum yang di perlukan untuk melepas satu elektro dari atom berwujud gas pada ke adaan dasarnya. Besar energy ionisasi merupakan ukuran usaha yang yang di perlukan untuk memaksa satu atom untuk melepaskan elektronnya, atau bagaimana eratnya electron terikat dalam atom.
Kereatifan adalah satu sifat yang mencerminkan seberapa cepat atau lambatnya suatu unsur itu dapat bereaksi dengan larutan atau campuran.

Dan yang di maksud dengan keelektronegatifan adalah kecenderungan atau kemampuan suatu atom untuk menarik electron dari atom lain.

BAB 5
PENUTUP

5.1 Kesimpulan
Dari percobaan yang telah dilakukan dapat di ambil kesimpulan bahwa:
– Dalam satu golongan unsure-unsur yang terdapat di dalamnya bersifat asam maka semakin ke atas sifat kelarutannya semakin besar apabila semakin ke bawah sifat kelaritannya semakin kecil, sedangkan bila dalam satu golongan seluruh unsur-unsur yang terdapat di dalamnya bersifat basa maka semakin ke atas tngkat kelarutannya semakin kecil apabila semakin ke bawah sifat kelarutannya semakin besar.

– Fungsi dari indikator fenolftalien adalah untuk mengetahui sifat suatu larutan basa atau asam, bila larutan bersifat basa maka bila di campurkan indicator pp maka akan merubah warna seprtim pda percobaan pita Mg dan K, sedangkan bila bersifat asam bila di campurkan indikator pp larutan tidak berubah warna.

– KSP sangat berpengaruh terhadap kelarutan. Suatu larutan jika hasil kali ion-ion asam lebih kecil atau sama dengan KSP garam, maka campuran akan larut, dengan larutnya campran maka endapan yang terjadi sedikit atau bahkan tidak ada, sedangkan hasil kali ion-ion asam lebih besar dari pada KSP garam, maka campuran menjadi kurang larut dengan kurang larutnya campuran maka akan terjadi pengendapan.

5.2 Saran
Sebaiknya unsur-unsur yang dipakai untuk percobaan ditambah, seperti Na, Li, Be dan yang lainnya.

DAFTAR PUSTAKA

Bresnik, Stephen . 2002 . Kimia Umum . Hipokrates : Jakarta
Petrucci, Ralph . 1996 . Kimia Dasar . Erlangga : Jakarta
Respati . 1999 . Ilmu Kimia . Rieneka Cipta : Yogyakarta